Lineage for d3c60d2 (3c60 D:1-120)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642475Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1642557Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (6 PDB entries)
  8. 1642566Domain d3c60d2: 3c60 D:1-120 [155964]
    Other proteins in same PDB: d3c60a1, d3c60a2, d3c60b1, d3c60b2, d3c60c1, d3c60c2, d3c60d1, d3c60e1, d3c60e2, d3c60f1, d3c60f2, d3c60g1, d3c60g2, d3c60h1
    automated match to d1lnub2

Details for d3c60d2

PDB Entry: 3c60 (more details), 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62
PDB Compounds: (D:) 3K peptide, Linker, and H-2 class II histocompatibility antigen (A beta chain)

SCOPe Domain Sequences for d3c60d2:

Sequence, based on SEQRES records: (download)

>d3c60d2 d.19.1.1 (D:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdggggslvprgsggggserhfvyqfmgecyftngtqriryvtryiynr
eeyvrydsdvgehravtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

Sequence, based on observed residues (ATOM records): (download)

>d3c60d2 d.19.1.1 (D:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavderhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehrav
telgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

SCOPe Domain Coordinates for d3c60d2:

Click to download the PDB-style file with coordinates for d3c60d2.
(The format of our PDB-style files is described here.)

Timeline for d3c60d2: