Lineage for d3c5zc1 (3c5z C:83-182)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107077Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1107127Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1107144Domain d3c5zc1: 3c5z C:83-182 [155953]
    Other proteins in same PDB: d3c5zc2, d3c5zd1, d3c5zd2, d3c5zg2, d3c5zh1, d3c5zh2
    automatically matched to d1k2da1

Details for d3c5zc1

PDB Entry: 3c5z (more details), 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c5zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5zc1 b.1.1.2 (C:83-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d3c5zc1:

Click to download the PDB-style file with coordinates for d3c5zc1.
(The format of our PDB-style files is described here.)

Timeline for d3c5zc1: