Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (26 PDB entries) |
Domain d3c5fb1: 3c5f B:250-328 [155940] Other proteins in same PDB: d3c5fa2, d3c5fa3, d3c5fb2, d3c5fb3 automated match to d1rzta1 protein/DNA complex; complexed with na; mutant |
PDB Entry: 3c5f (more details), 2.25 Å
SCOPe Domain Sequences for d3c5fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5fb1 a.60.6.1 (B:250-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm aekiieilesghlrkldhi
Timeline for d3c5fb1: