SCOPe 2.04: Domain d3c5fb1: 3c5f B:250-328

Lineage for d3c5fb1 (3c5f B:250-328)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (26 PDB entries)

8. Domain d3c5fb1: 3c5f B:250-328 [155940]
   Other proteins in same PDB: d3c5fa2, d3c5fa3, d3c5fb2, d3c5fb3
   automated match to d1rzta1
   protein/DNA complex; complexed with na; mutant

Details for d3c5fb1

PDB Entry: 3c5f, 2.25 Å

PDB Description: structure of a binary complex of the r517a pol lambda mutant

PDB Compounds: (B:) DNA polymerase lambda

SCOPe Domain Sequences for d3c5fb1:

Sequence; same for both SEQRES and ATOM records:

>d3c5fb1 a.60.6.1 (B:250-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
aekiieilesghlrkldhi

Timeline for d3c5fb1:

• d3c5fb1 first appeared in SCOP 1.75
  
• d3c5fb1 appears in SCOPe 2.03
  
• d3c5fb1 appears in SCOPe 2.05
  
• d3c5fb1 appears in the current release, SCOPe 2.08