Lineage for d3c3tb1 (3c3t B:1-83)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760436Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 760489Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 760519Domain d3c3tb1: 3c3t B:1-83 [155921]
    Other proteins in same PDB: d3c3ta2, d3c3tb2
    automatically matched to d1ap5a1
    complexed with mn, so4; mutant

Details for d3c3tb1

PDB Entry: 3c3t (more details), 2.2 Å

PDB Description: role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOP Domain Sequences for d3c3tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3tb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d3c3tb1:

Click to download the PDB-style file with coordinates for d3c3tb1.
(The format of our PDB-style files is described here.)

Timeline for d3c3tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c3tb2