SCOPe 2.06: Domain d1gcwb_: 1gcw B:

Lineage for d1gcwb_ (1gcw B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Houndshark (Mustelus griseus) [TaxId:89020] [46515] (2 PDB entries)

8. Domain d1gcwb_: 1gcw B: [15591]
   Other proteins in same PDB: d1gcwa_, d1gcwc_
   complexed with cmo, hem

Details for d1gcwb_

PDB Entry: 1gcw, 2 Å

PDB Description: CO form hemoglobin from mustelus griseus

PDB Compounds: (B:) protein (hemoglobin)

SCOPe Domain Sequences for d1gcwb_:

Sequence, based on SEQRES records:

>d1gcwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
dkffevvidaisk

Sequence, based on observed residues (ATOM records):

>d1gcwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
evvidaisk

Timeline for d1gcwb_:

• d1gcwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gcwb_ appears in SCOPe 2.05
  
• d1gcwb_ appears in SCOPe 2.07
  
• d1gcwb_ appears in the current release, SCOPe 2.08