Lineage for d3c2la3 (3c2l A:149-335)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686025Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1686026Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 1686027Species Human (Homo sapiens) [TaxId:9606] [81574] (143 PDB entries)
    Uniprot P06746
  8. 1686076Domain d3c2la3: 3c2l A:149-335 [155881]
    Other proteins in same PDB: d3c2la1, d3c2la2
    automated match to d1tv9a3
    protein/DNA complex; complexed with f2a, mn, na

Details for d3c2la3

PDB Entry: 3c2l (more details), 2.6 Å

PDB Description: ternary complex of dna polymerase beta with a c:dapcpp mismatch in the active site
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3c2la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2la3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d3c2la3:

Click to download the PDB-style file with coordinates for d3c2la3.
(The format of our PDB-style files is described here.)

Timeline for d3c2la3: