Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Human (Homo sapiens) [TaxId:9606] [47805] (107 PDB entries) Uniprot P06746 |
Domain d3c2ka1: 3c2k A:10-91 [155876] Other proteins in same PDB: d3c2ka2, d3c2ka3 automatically matched to d1bpxa1 complexed with cl, dup, mn, na |
PDB Entry: 3c2k (more details), 2.4 Å
SCOP Domain Sequences for d3c2ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2ka1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki aekideflatgklrklekirqd
Timeline for d3c2ka1: