Lineage for d3c2ka1 (3c2k A:10-91)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771080Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 771081Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 771082Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 771083Species Human (Homo sapiens) [TaxId:9606] [47805] (107 PDB entries)
    Uniprot P06746
  8. 771094Domain d3c2ka1: 3c2k A:10-91 [155876]
    Other proteins in same PDB: d3c2ka2, d3c2ka3
    automatically matched to d1bpxa1
    complexed with cl, dup, mn, na

Details for d3c2ka1

PDB Entry: 3c2k (more details), 2.4 Å

PDB Description: dna polymerase beta with a gapped dna substrate and dumpnpp with manganese in the active site
PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d3c2ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2ka1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOP Domain Coordinates for d3c2ka1:

Click to download the PDB-style file with coordinates for d3c2ka1.
(The format of our PDB-style files is described here.)

Timeline for d3c2ka1: