SCOPe 2.01: Domain d3c1cd1: 3c1c D:1230-1322

Lineage for d3c1cd1 (3c1c D:1230-1322)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Xenopus (Silurana) tropicalis [TaxId:8364] [158385] (2 PDB entries)

8. Domain d3c1cd1: 3c1c D:1230-1322 [155861]
   Other proteins in same PDB: d3c1cb1, d3c1cc1, d3c1cf1, d3c1cg1
   automatically matched to d1s32d_
   protein/DNA complex

Details for d3c1cd1

PDB Entry: 3c1c, 3.15 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure

PDB Compounds: (D:) Histone 2, H2bf

SCOPe Domain Sequences for d3c1cd1:

Sequence; same for both SEQRES and ATOM records:

>d3c1cd1 a.22.1.1 (D:1230-1322) Histone H2B {Xenopus (Silurana) tropicalis [TaxId: 8364]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d3c1cd1:

• d3c1cd1 first appeared in SCOP 1.75
  
• d3c1cd1 appears in SCOPe 2.02
  
• d3c1cd1 appears in the current release, SCOPe 2.08