Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Protein kinase CK2, alpha subunit [56142] (3 species) CMGC group; CK2 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries) |
Domain d3c13a_: 3c13 A: [155850] automated match to d1jwha_ complexed with cl, emo |
PDB Entry: 3c13 (more details), 1.95 Å
SCOPe Domain Sequences for d3c13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c13a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]} gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld kllrydhqsrltareamehpyfytvvkd
Timeline for d3c13a_: