Lineage for d1cg5b_ (1cg5 B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276117Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 276129Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46512] (2 PDB entries)
  8. 276130Domain d1cg5b_: 1cg5 B: [15585]
    Other proteins in same PDB: d1cg5a_
    complexed with hem

Details for d1cg5b_

PDB Entry: 1cg5 (more details), 1.6 Å

PDB Description: deoxy form hemoglobin from dasyatis akajei

SCOP Domain Sequences for d1cg5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei)}
vklsedqehyikgvwkdvdhkqitakalervfvvypwttrlfsklqglfsandigvqqha
dkvqralgeaiddlkkveinfqnlsgkhqeigvdtqnfkllgqtfmvelalhykktfrpk
ehaaaykffrlvaealssnyh

SCOP Domain Coordinates for d1cg5b_:

Click to download the PDB-style file with coordinates for d1cg5b_.
(The format of our PDB-style files is described here.)

Timeline for d1cg5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cg5a_