SCOP 1.65: Domain d1hbhb_: 1hbh B:

Lineage for d1hbhb_ (1hbh B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Antarctic fish (Pagothenia bernacchii) [46511] (2 PDB entries)

8. Domain d1hbhb_: 1hbh B: [15583]
   Other proteins in same PDB: d1hbha_, d1hbhc_

Details for d1hbhb_

PDB Entry: 1hbh, 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbhb_:

Sequence; same for both SEQRES and ATOM records:

>d1hbhb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Pagothenia bernacchii)}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d1hbhb_:

• d1hbhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbhb_ appears in SCOP 1.63
  
• d1hbhb_ appears in SCOP 1.67
  
• d1hbhb_ appears in the current release, SCOPe 2.08