SCOP 1.63: Domain d1pbxb_: 1pbx B:

Lineage for d1pbxb_ (1pbx B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Antarctic fish (Pagothenia bernacchii) [46511] (2 PDB entries)

8. Domain d1pbxb_: 1pbx B: [15582]
   Other proteins in same PDB: d1pbxa_
   complexed with hem

Details for d1pbxb_

PDB Entry: 1pbx, 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative

SCOP Domain Sequences for d1pbxb_:

Sequence; same for both SEQRES and ATOM records:

>d1pbxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Pagothenia bernacchii)}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d1pbxb_:

• d1pbxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pbxb_ appears in SCOP 1.61
  
• d1pbxb_ appears in SCOP 1.65
  
• d1pbxb_ appears in the current release, SCOPe 2.08