Lineage for d3c09c1 (3c09 C:2-121)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021762Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2021831Domain d3c09c1: 3c09 C:2-121 [155813]
    Other proteins in same PDB: d3c09a1, d3c09a2, d3c09a3, d3c09c2, d3c09d1, d3c09d2, d3c09d3, d3c09h2
    automatically matched to d8fabb1
    complexed with bma, man, nag

Details for d3c09c1

PDB Entry: 3c09 (more details), 3.2 Å

PDB Description: crystal structure the fab fragment of matuzumab (fab72000) in complex with domain iii of the extracellular region of egfr
PDB Compounds: (C:) Matuzumab Fab Heavy chain

SCOPe Domain Sequences for d3c09c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c09c1 b.1.1.1 (C:2-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtnyn
ekfkskatmtvdtstntaymelsslrsedtavyycasrdydyagryfdywgqgtlvtvss

SCOPe Domain Coordinates for d3c09c1:

Click to download the PDB-style file with coordinates for d3c09c1.
(The format of our PDB-style files is described here.)

Timeline for d3c09c1: