Lineage for d3c08h1 (3c08 H:2-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781920Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 781929Domain d3c08h1: 3c08 H:2-121 [155809]
    Other proteins in same PDB: d3c08h2
    automatically matched to d8fabb1
    complexed with so4

Details for d3c08h1

PDB Entry: 3c08 (more details), 2.15 Å

PDB Description: crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
PDB Compounds: (H:) Matuzumab Fab Heavy chain

SCOP Domain Sequences for d3c08h1:

Sequence, based on SEQRES records: (download)

>d3c08h1 b.1.1.1 (H:2-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtnyn
ekfkskatmtvdtstntaymelsslrsedtavyycasrdydydgryfdywgqgtlvtvss

Sequence, based on observed residues (ATOM records): (download)

>d3c08h1 b.1.1.1 (H:2-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlvqsgaevkkpgasvkvsckashwmhwvrqapgqglewigefnpsngrtnynekfksk
atmtvdtstntaymelsslrsedtavyycasrdydydgryfdywgqgtlvtvss

SCOP Domain Coordinates for d3c08h1:

Click to download the PDB-style file with coordinates for d3c08h1.
(The format of our PDB-style files is described here.)

Timeline for d3c08h1: