Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
Domain d3bzfc2: 3bzf C:2-181 [155773] Other proteins in same PDB: d3bzfa1, d3bzfb_, d3bzfc1, d3bzfd_ automatically matched to d1mhea2 |
PDB Entry: 3bzf (more details), 2.5 Å
SCOPe Domain Sequences for d3bzfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzfc2 d.19.1.1 (C:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]} shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d3bzfc2:
View in 3D Domains from other chains: (mouse over for more information) d3bzfa1, d3bzfa2, d3bzfb_, d3bzfd_ |