Lineage for d3bzeg2 (3bze G:2-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021100Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 1021107Domain d3bzeg2: 3bze G:2-181 [155767]
    Other proteins in same PDB: d3bzea1, d3bzeb_, d3bzec1, d3bzed_, d3bzee1, d3bzef_, d3bzeg1, d3bzeh_
    automatically matched to d1mhea2

Details for d3bzeg2

PDB Entry: 3bze (more details), 2.5 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E
PDB Compounds: (G:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d3bzeg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzeg2 d.19.1.1 (G:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d3bzeg2:

Click to download the PDB-style file with coordinates for d3bzeg2.
(The format of our PDB-style files is described here.)

Timeline for d3bzeg2: