![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries) |
![]() | Domain d3bzeg2: 3bze G:2-181 [155767] Other proteins in same PDB: d3bzea1, d3bzeb_, d3bzec1, d3bzed_, d3bzee1, d3bzef_, d3bzeg1, d3bzeh_ automatically matched to d1mhea2 |
PDB Entry: 3bze (more details), 2.5 Å
SCOPe Domain Sequences for d3bzeg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzeg2 d.19.1.1 (G:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]} shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d3bzeg2: