Lineage for d3bzee2 (3bze E:2-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545038Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (8 PDB entries)
  8. 2545044Domain d3bzee2: 3bze E:2-181 [155764]
    Other proteins in same PDB: d3bzea1, d3bzeb2, d3bzeb3, d3bzec1, d3bzed2, d3bzed3, d3bzee1, d3bzef2, d3bzef3, d3bzeg1, d3bzeh2, d3bzeh3
    automatically matched to d1mhea2

Details for d3bzee2

PDB Entry: 3bze (more details), 2.5 Å

PDB Description: The human non-classical major histocompatibility complex molecule HLA-E
PDB Compounds: (E:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d3bzee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzee2 d.19.1.1 (E:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d3bzee2:

Click to download the PDB-style file with coordinates for d3bzee2.
(The format of our PDB-style files is described here.)

Timeline for d3bzee2: