Lineage for d1hv4d_ (1hv4 D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759020Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries)
  8. 759024Domain d1hv4d_: 1hv4 D: [15576]
    Other proteins in same PDB: d1hv4a_, d1hv4c_, d1hv4e_, d1hv4g_

Details for d1hv4d_

PDB Entry: 1hv4 (more details), 2.8 Å

PDB Description: crystal structure analysis of bar-head goose hemoglobin (deoxy form)
PDB Compounds: (D:) hemoglobin beta chain

SCOP Domain Sequences for d1hv4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv4d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1hv4d_:

Click to download the PDB-style file with coordinates for d1hv4d_.
(The format of our PDB-style files is described here.)

Timeline for d1hv4d_: