SCOP 1.69: Domain d1a4fb_: 1a4f B:

Lineage for d1a4fb_ (1a4f B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (20 species)

7. Species Bar-headed goose (Anser indicus) [TaxId:8846] [46509] (3 PDB entries)

8. Domain d1a4fb_: 1a4f B: [15573]
   Other proteins in same PDB: d1a4fa_

Details for d1a4fb_

PDB Entry: 1a4f, 2 Å

PDB Description: bar-headed goose hemoglobin (oxy form)

SCOP Domain Sequences for d1a4fb_:

Sequence; same for both SEQRES and ATOM records:

>d1a4fb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Bar-headed goose (Anser indicus)}
vhwsaeekqlitglwgkvnvadcgaealarllivypwtqrffssfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpdcqaawqklvrvvahalarkyh

Timeline for d1a4fb_:

• d1a4fb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4fb_ appears in SCOP 1.67
  
• d1a4fb_ appears in SCOP 1.71
  
• d1a4fb_ appears in the current release, SCOPe 2.08