Lineage for d1hbrd_ (1hbr D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300502Species Chicken (Gallus gallus) [TaxId:9031] [46508] (1 PDB entry)
  8. 2300504Domain d1hbrd_: 1hbr D: [15572]
    Other proteins in same PDB: d1hbra_, d1hbrc_
    complexed with hem

Details for d1hbrd_

PDB Entry: 1hbr (more details), 2.3 Å

PDB Description: r-state form of chicken hemoglobin d
PDB Compounds: (D:) protein (hemoglobin d)

SCOPe Domain Sequences for d1hbrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbrd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Chicken (Gallus gallus) [TaxId: 9031]}
vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
dftpecqaawqklvrvvahalarkyh

SCOPe Domain Coordinates for d1hbrd_:

Click to download the PDB-style file with coordinates for d1hbrd_.
(The format of our PDB-style files is described here.)

Timeline for d1hbrd_: