Lineage for d1hbrd_ (1hbr D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44257Species Chicken (Gallus gallus) [TaxId:9031] [46508] (1 PDB entry)
  8. 44259Domain d1hbrd_: 1hbr D: [15572]
    Other proteins in same PDB: d1hbra_, d1hbrc_

Details for d1hbrd_

PDB Entry: 1hbr (more details), 2.3 Å

PDB Description: r-state form of chicken hemoglobin d

SCOP Domain Sequences for d1hbrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbrd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Chicken (Gallus gallus)}
vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv
rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk
dftpecqaawqklvrvvahalarkyh

SCOP Domain Coordinates for d1hbrd_:

Click to download the PDB-style file with coordinates for d1hbrd_.
(The format of our PDB-style files is described here.)

Timeline for d1hbrd_: