Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (11 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (38 PDB entries) Uniprot P02593 |
Domain d3bxkc1: 3bxk C:5-146 [155717] automatically matched to d1cfca_ complexed with ca, so4 |
PDB Entry: 3bxk (more details), 2.55 Å
SCOP Domain Sequences for d3bxkc1:
Sequence, based on SEQRES records: (download)
>d3bxkc1 a.39.1.5 (C:5-146) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem ireadidgdgqvnyeefvqmmt
>d3bxkc1 a.39.1.5 (C:5-146) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid fpefltmmarkmdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemi readidgdgqvnyeefvqmmt
Timeline for d3bxkc1: