Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46508] (1 PDB entry) |
Domain d1hbrb_: 1hbr B: [15571] Other proteins in same PDB: d1hbra_, d1hbrc_ complexed with hem |
PDB Entry: 1hbr (more details), 2.3 Å
SCOPe Domain Sequences for d1hbrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbrb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Chicken (Gallus gallus) [TaxId: 9031]} vhwtaeekqlitglwgkvnvaecgaealarllivypwtqrffasfgnlssptailgnpmv rahgkkvltsfgdavknldnikntfsqlselhcdklhvdpenfrllgdiliivlaahfsk dftpecqaawqklvrvvahalark
Timeline for d1hbrb_: