SCOP 1.63: Domain d1qpwb_: 1qpw B:

Lineage for d1qpwb_ (1qpw B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46507] (2 PDB entries)

8. Domain d1qpwb_: 1qpw B: [15569]
   Other proteins in same PDB: d1qpwa_, d1qpwc_

Details for d1qpwb_

PDB Entry: 1qpw, 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

SCOP Domain Sequences for d1qpwb_:

Sequence; same for both SEQRES and ATOM records:

>d1qpwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Pig (Sus scrofa)}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

Timeline for d1qpwb_:

• d1qpwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpwb_ appears in SCOP 1.61
  
• d1qpwb_ appears in SCOP 1.65
  
• d1qpwb_ appears in the current release, SCOPe 2.08