SCOPe 2.06: Domain d3bwaa1: 3bwa A:182-276

Lineage for d3bwaa1 (3bwa A:182-276)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3bwaa1: 3bwa A:182-276 [155683]
   Other proteins in same PDB: d3bwaa2, d3bwab2, d3bwab3
   automated match to d1a9ea1

Details for d3bwaa1

PDB Entry: 3bwa, 1.3 Å

PDB Description: crystal structure of hla b*3508 in complex with a hcmv 8-mer peptide from the pp65 protein

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOPe Domain Sequences for d3bwaa1:

Sequence; same for both SEQRES and ATOM records:

>d3bwaa1 b.1.1.0 (A:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d3bwaa1:

• d3bwaa1 first appeared in SCOP 1.75
  
• d3bwaa1 appears in SCOPe 2.05
  
• d3bwaa1 appears in SCOPe 2.07
  
• d3bwaa1 appears in the current release, SCOPe 2.08