Lineage for d2pghd_ (2pgh D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44437Species Pig (Sus scrofa) [TaxId:9823] [46507] (2 PDB entries)
  8. 44441Domain d2pghd_: 2pgh D: [15568]
    Other proteins in same PDB: d2pgha_, d2pghc_

Details for d2pghd_

PDB Entry: 2pgh (more details), 2.8 Å

PDB Description: structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution

SCOP Domain Sequences for d2pghd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pghd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Pig (Sus scrofa)}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpdvqaafqkvvagvanalahkyh

SCOP Domain Coordinates for d2pghd_:

Click to download the PDB-style file with coordinates for d2pghd_.
(The format of our PDB-style files is described here.)

Timeline for d2pghd_: