Lineage for d3bw5a1 (3bw5 A:2-335)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875082Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 875083Species Human (Homo sapiens) [TaxId:9606] [75559] (4 PDB entries)
  8. 875084Domain d3bw5a1: 3bw5 A:2-335 [155679]
    complexed with anp, cl, gol; mutant

Details for d3bw5a1

PDB Entry: 3bw5 (more details), 1.66 Å

PDB Description: Crystal structure of a mutant of human protein kinase CK2alpha with altered cosubstrate specificity
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOP Domain Sequences for d3bw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bw5a1 d.144.1.7 (A:2-335) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvavkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvlidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmg

SCOP Domain Coordinates for d3bw5a1:

Click to download the PDB-style file with coordinates for d3bw5a1.
(The format of our PDB-style files is described here.)

Timeline for d3bw5a1:

  • d3bw5a1 is new in SCOP 1.75
  • d3bw5a1 does not appear in SCOPe 2.01