SCOP 1.75: Domain d3bvdb2: 3bvd B:3-36

Lineage for d3bvdb2 (3bvd B:3-36)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d3bvdb2: 3bvd B:3-36 [155661]
   Other proteins in same PDB: d3bvdb1, d3bvdc1
   automatically matched to d1ehkb2
   complexed with cu, cua, has, hem, xe; mutant

Details for d3bvdb2

PDB Entry: 3bvd, 3.37 Å

PDB Description: structure of surface-engineered cytochrome ba3 oxidase from thermus thermophilus under xenon pressure, 100psi 5min

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d3bvdb2:

Sequence; same for both SEQRES and ATOM records:

>d3bvdb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dqhkahkailayekgwlafslamlfvfialiayt

Timeline for d3bvdb2:

• d3bvdb2 is new in SCOP 1.75
  
• d3bvdb2 appears in SCOPe 2.01
  
• d3bvdb2 appears in the current release, SCOPe 2.08