SCOP 1.75: Domain d1hdad_: 1hda D:

Lineage for d1hdad_ (1hda D:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46506] (8 PDB entries)

8. Domain d1hdad_: 1hda D: [15566]
   Other proteins in same PDB: d1hdaa_, d1hdac_
   complexed with hem

Details for d1hdad_

PDB Entry: 1hda, 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin

PDB Compounds: (D:) hemoglobin (deoxy) (beta chain)

SCOP Domain Sequences for d1hdad_:

Sequence; same for both SEQRES and ATOM records:

>d1hdad_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d1hdad_:

• d1hdad_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdad_ appears in SCOP 1.73
  
• d1hdad_ appears in SCOPe 2.01
  
• d1hdad_ appears in the current release, SCOPe 2.08