Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Cow (Bos taurus) [TaxId:9913] [46506] (8 PDB entries) |
Domain d1hdad_: 1hda D: [15566] Other proteins in same PDB: d1hdaa_, d1hdac_ complexed with hem |
PDB Entry: 1hda (more details), 2.2 Å
SCOP Domain Sequences for d1hdad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdad_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]} mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke ftpvlqadfqkvvagvanalahryh
Timeline for d1hdad_: