Lineage for d1hdad_ (1hda D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44260Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 44270Domain d1hdad_: 1hda D: [15566]
    Other proteins in same PDB: d1hdaa_, d1hdac_

Details for d1hdad_

PDB Entry: 1hda (more details), 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin

SCOP Domain Sequences for d1hdad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdad_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1hdad_:

Click to download the PDB-style file with coordinates for d1hdad_.
(The format of our PDB-style files is described here.)

Timeline for d1hdad_: