Lineage for d3buza1 (3buz A:1-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000475Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species)
    mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component)
  7. 3000476Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries)
  8. 3000483Domain d3buza1: 3buz A:1-209 [155656]
    Other proteins in same PDB: d3buzb1, d3buzb2
    automated match to d1giqa1
    complexed with atp, ca, lar, tad

Details for d3buza1

PDB Entry: 3buz (more details), 2.81 Å

PDB Description: Crystal structure of ia-bTAD-actin complex
PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d3buza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buza1 d.166.1.1 (A:1-209) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
afierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfy
dyqiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfn
elketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlie
qdysikidkivriviegkqyikaeasivn

SCOPe Domain Coordinates for d3buza1:

Click to download the PDB-style file with coordinates for d3buza1.
(The format of our PDB-style files is described here.)

Timeline for d3buza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3buza2