Lineage for d3buyb1 (3buy B:1-99)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784300Domain d3buyb1: 3buy B:1-99 [155655]
    Other proteins in same PDB: d3buya1, d3buya2
    automatically matched to d1bz9b_

Details for d3buyb1

PDB Entry: 3buy (more details), 2.6 Å

PDB Description: MHC-I in complex with peptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOP Domain Sequences for d3buyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buyb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d3buyb1:

Click to download the PDB-style file with coordinates for d3buyb1.
(The format of our PDB-style files is described here.)

Timeline for d3buyb1: