SCOP 1.75: Domain d3buyb1: 3buy B:1-99

Lineage for d3buyb1 (3buy B:1-99)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d3buyb1: 3buy B:1-99 [155655]
   Other proteins in same PDB: d3buya1, d3buya2
   automatically matched to d1bz9b_

Details for d3buyb1

PDB Entry: 3buy, 2.6 Å

PDB Description: MHC-I in complex with peptide

PDB Compounds: (B:) Beta-2-microglobulin

SCOP Domain Sequences for d3buyb1:

Sequence; same for both SEQRES and ATOM records:

>d3buyb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d3buyb1:

• d3buyb1 is new in SCOP 1.75
  
• d3buyb1 is called d3buyb_ in SCOPe 2.01
  
• d3buyb1 appears in the current release, SCOPe 2.08, called d3buyb_