Lineage for d1hdab_ (1hda B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632329Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 632338Domain d1hdab_: 1hda B: [15565]
    Other proteins in same PDB: d1hdaa_, d1hdac_

Details for d1hdab_

PDB Entry: 1hda (more details), 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin
PDB Compounds: (B:) hemoglobin (deoxy) (beta chain)

SCOP Domain Sequences for d1hdab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdab_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1hdab_:

Click to download the PDB-style file with coordinates for d1hdab_.
(The format of our PDB-style files is described here.)

Timeline for d1hdab_: