SCOP 1.59: Domain d1hdab_: 1hda B:

Lineage for d1hdab_ (1hda B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)

8. Domain d1hdab_: 1hda B: [15565]
   Other proteins in same PDB: d1hdaa_, d1hdac_

Details for d1hdab_

PDB Entry: 1hda, 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin

SCOP Domain Sequences for d1hdab_:

Sequence; same for both SEQRES and ATOM records:

>d1hdab_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d1hdab_:

• d1hdab_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdab_ appears in SCOP 1.57
  
• d1hdab_ appears in SCOP 1.61
  
• d1hdab_ appears in the current release, SCOPe 2.08