Lineage for d1g09d_ (1g09 D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436496Protein Hemoglobin, beta-chain [46500] (20 species)
  7. 436520Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 436524Domain d1g09d_: 1g09 D: [15564]
    Other proteins in same PDB: d1g09a_, d1g09c_

Details for d1g09d_

PDB Entry: 1g09 (more details), 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 7.2

SCOP Domain Sequences for d1g09d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g09d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1g09d_:

Click to download the PDB-style file with coordinates for d1g09d_.
(The format of our PDB-style files is described here.)

Timeline for d1g09d_: