SCOPe 2.05: Domain d1g09b_: 1g09 B:

Lineage for d1g09b_ (1g09 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46506] (11 PDB entries)

8. Domain d1g09b_: 1g09 B: [15563]
   Other proteins in same PDB: d1g09a_, d1g09c_
   complexed with cmo, hem

Details for d1g09b_

PDB Entry: 1g09, 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 7.2

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1g09b_:

Sequence; same for both SEQRES and ATOM records:

>d1g09b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d1g09b_:

• d1g09b_ first appeared (with stable ids) in SCOP 1.55
  
• d1g09b_ appears in SCOPe 2.04
  
• d1g09b_ appears in SCOPe 2.06
  
• d1g09b_ appears in the current release, SCOPe 2.08