Lineage for d1g0ab_ (1g0a B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349705Protein Hemoglobin, beta-chain [46500] (19 species)
  7. 349721Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 349726Domain d1g0ab_: 1g0a B: [15561]
    Other proteins in same PDB: d1g0aa_, d1g0ac_

Details for d1g0ab_

PDB Entry: 1g0a (more details), 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 8.5

SCOP Domain Sequences for d1g0ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ab_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1g0ab_:

Click to download the PDB-style file with coordinates for d1g0ab_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ab_: