Lineage for d1g08b_ (1g08 B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148559Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 148577Species Cow (Bos taurus) [TaxId:9913] [46506] (5 PDB entries)
  8. 148578Domain d1g08b_: 1g08 B: [15559]
    Other proteins in same PDB: d1g08a_, d1g08c_

Details for d1g08b_

PDB Entry: 1g08 (more details), 1.9 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 5.0

SCOP Domain Sequences for d1g08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g08b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus)}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d1g08b_:

Click to download the PDB-style file with coordinates for d1g08b_.
(The format of our PDB-style files is described here.)

Timeline for d1g08b_: