SCOPe 2.05: Domain d1hdsb_: 1hds B:

Lineage for d1hdsb_ (1hds B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Deer (Odocoileus virginianus) [TaxId:9874] [46505] (1 PDB entry)

8. Domain d1hdsb_: 1hds B: [15557]
   Other proteins in same PDB: d1hdsa_, d1hdsc_
   complexed with hem

Details for d1hdsb_

PDB Entry: 1hds, 1.98 Å

PDB Description: macromolecular structure refinement by restrained least-squares and interactive graphics as applied to sickling deer type iii hemoglobin

PDB Compounds: (B:) hemoglobin s (deoxy) (beta chain)

SCOPe Domain Sequences for d1hdsb_:

Sequence; same for both SEQRES and ATOM records:

>d1hdsb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Deer (Odocoileus virginianus) [TaxId: 9874]}
mltaeekaavtgfwgkvdvdvvgaqalgrllvvypwtqrffqhfgnlssagavmnnpkvk
ahgkrvldaftqglkhlddlkgafaqlsglhcnklhvnpqnfrllgnvlalvvarnfggq
ftpnvqalfqkvvagvanalahkyh

Timeline for d1hdsb_:

• d1hdsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdsb_ appears in SCOPe 2.04
  
• d1hdsb_ appears in SCOPe 2.06
  
• d1hdsb_ appears in the current release, SCOPe 2.08