SCOP 1.61: Domain d2mhbb_: 2mhb B:

Lineage for d2mhbb_ (2mhb B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (4 PDB entries)

8. Domain d2mhbb_: 2mhb B: [15555]
   Other proteins in same PDB: d2mhba_

Details for d2mhbb_

PDB Entry: 2mhb, 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution

SCOP Domain Sequences for d2mhbb_:

Sequence; same for both SEQRES and ATOM records:

>d2mhbb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d2mhbb_:

• d2mhbb_ first appeared (with stable ids) in SCOP 1.55
  
• d2mhbb_ appears in SCOP 1.59
  
• d2mhbb_ appears in SCOP 1.63
  
• d2mhbb_ appears in the current release, SCOPe 2.08