Lineage for d3bt2u2 (3bt2 U:189-275)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063196Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species)
    duplication; comprises three domains of this fold
  7. 1063197Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries)
    Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104
  8. 1063202Domain d3bt2u2: 3bt2 U:189-275 [155548]
    Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2
    automatically matched to 2FD6 U:189-275
    complexed with nag

Details for d3bt2u2

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3bt2u2:

Sequence, based on SEQRES records: (download)

>d3bt2u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
hahlgdafsmnhidvscctksgcnhpd

Sequence, based on observed residues (ATOM records): (download)

>d3bt2u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
lgdafsmnhidvscctksgcnhpd

SCOPe Domain Coordinates for d3bt2u2:

Click to download the PDB-style file with coordinates for d3bt2u2.
(The format of our PDB-style files is described here.)

Timeline for d3bt2u2: