![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins) |
![]() | Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species) duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161129] (5 PDB entries) Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108 |
![]() | Domain d3bt2u1: 3bt2 U:1-80 [155547] Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2 automatically matched to 2FD6 U:1-80 complexed with nag |
PDB Entry: 3bt2 (more details), 2.5 Å
SCOPe Domain Sequences for d3bt2u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt2u1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]} lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg lkitsltevvcgldlcnqgn
Timeline for d3bt2u1: