Lineage for d3bt2l1 (3bt2 L:1-106A)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034942Domain d3bt2l1: 3bt2 L:1-106A [155545]
    Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
    automated match to d1h3pl1
    complexed with nag

Details for d3bt2l1

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (L:) anti-uPAR antibody, light chain

SCOPe Domain Sequences for d3bt2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2l1 b.1.1.0 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

SCOPe Domain Coordinates for d3bt2l1:

Click to download the PDB-style file with coordinates for d3bt2l1.
(The format of our PDB-style files is described here.)

Timeline for d3bt2l1: