Lineage for d3bt2h1 (3bt2 H:1-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022086Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2022218Domain d3bt2h1: 3bt2 H:1-113 [155543]
    Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h2, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
    automatically matched to 2FD6 H:1-113
    complexed with nag

Details for d3bt2h1

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (H:) anti-uPAR antibody, heavy chain

SCOPe Domain Sequences for d3bt2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvss

SCOPe Domain Coordinates for d3bt2h1:

Click to download the PDB-style file with coordinates for d3bt2h1.
(The format of our PDB-style files is described here.)

Timeline for d3bt2h1: