![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.64: Somatomedin B domain [90187] (1 superfamily) disulfide-rich |
![]() | Superfamily g.64.1: Somatomedin B domain [90188] (1 family) ![]() automatically mapped to Pfam PF01033 |
![]() | Family g.64.1.1: Somatomedin B domain [90189] (1 protein) |
![]() | Protein Vitronectin [90190] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries) Uniprot P04004 20-70 |
![]() | Domain d3bt2b_: 3bt2 B: [155542] Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3 automated match to d1s4ga_ complexed with nag |
PDB Entry: 3bt2 (more details), 2.5 Å
SCOPe Domain Sequences for d3bt2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt2b_ g.64.1.1 (B:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]} qesckgrctegfnvdkkcqcdelcsyyqscctdytaeckp
Timeline for d3bt2b_: