SCOPe 2.06: Domain d3bt2a2: 3bt2 A:50-132

Lineage for d3bt2a2 (3bt2 A:50-132)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Urokinase-type plasminogen activator [57453] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)

8. Domain d3bt2a2: 3bt2 A:50-132 [155541]
   Other proteins in same PDB: d3bt2a1, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
   automated match to d1urka2
   complexed with nag

Details for d3bt2a2

PDB Entry: 3bt2, 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3bt2a2:

Sequence; same for both SEQRES and ATOM records:

>d3bt2a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

Timeline for d3bt2a2:

• d3bt2a2 first appeared in SCOP 1.75
  
• d3bt2a2 appears in SCOPe 2.05
  
• d3bt2a2 appears in SCOPe 2.07
  
• d3bt2a2 appears in the current release, SCOPe 2.08