Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
Domain d3bt2a1: 3bt2 A:9-49 [155540] Other proteins in same PDB: d3bt2a2, d3bt2b_, d3bt2h1, d3bt2h2, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3 automated match to d1urka1 complexed with nag |
PDB Entry: 3bt2 (more details), 2.5 Å
SCOPe Domain Sequences for d3bt2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt2a1 g.3.11.1 (A:9-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} sncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d3bt2a1: