Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.8: Pumilio repeat [63611] (2 proteins) this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain |
Protein Pumilio 1 [63612] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries) |
Domain d3bsxb_: 3bsx B: [155530] automated match to d1m8yb_ protein/RNA complex |
PDB Entry: 3bsx (more details), 2.32 Å
SCOPe Domain Sequences for d3bsxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bsxb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]} grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk midvaepgqrkivmhkirphiatlrkytygkhilakleky
Timeline for d3bsxb_: