Lineage for d3bsxb_ (3bsx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2009945Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 2009946Protein Pumilio 1 [63612] (1 species)
  7. 2009947Species Human (Homo sapiens) [TaxId:9606] [63613] (13 PDB entries)
  8. 2009960Domain d3bsxb_: 3bsx B: [155530]
    automated match to d1m8yb_
    protein/RNA complex

Details for d3bsxb_

PDB Entry: 3bsx (more details), 2.32 Å

PDB Description: Crystal Structure of Human Pumilio 1 in complex with Puf5 RNA
PDB Compounds: (B:) Pumilio homolog 1

SCOPe Domain Sequences for d3bsxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsxb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilakleky

SCOPe Domain Coordinates for d3bsxb_:

Click to download the PDB-style file with coordinates for d3bsxb_.
(The format of our PDB-style files is described here.)

Timeline for d3bsxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bsxa_