Lineage for d3bsxb1 (3bsx B:829-1167)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775435Family a.118.1.8: Pumilio repeat [63611] (1 protein)
  6. 775436Protein Pumilio 1 [63612] (1 species)
  7. 775437Species Human (Homo sapiens) [TaxId:9606] [63613] (7 PDB entries)
  8. 775445Domain d3bsxb1: 3bsx B:829-1167 [155530]
    automatically matched to d1m8yb_

Details for d3bsxb1

PDB Entry: 3bsx (more details), 2.32 Å

PDB Description: Crystal Structure of Human Pumilio 1 in complex with Puf5 RNA
PDB Compounds: (B:) Pumilio homolog 1

SCOP Domain Sequences for d3bsxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsxb1 a.118.1.8 (B:829-1167) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}
rsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilqa
ayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefipsd
qqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygcr
viqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirgn
vlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqkm
idvaepgqrkivmhkirphiatlrkytygkhilakleky

SCOP Domain Coordinates for d3bsxb1:

Click to download the PDB-style file with coordinates for d3bsxb1.
(The format of our PDB-style files is described here.)

Timeline for d3bsxb1: