SCOP 1.67: Domain d1ibeb_: 1ibe B:

Lineage for d1ibeb_ (1ibe B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (19 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (5 PDB entries)

8. Domain d1ibeb_: 1ibe B: [15553]
   Other proteins in same PDB: d1ibea_
   complexed with hem

Details for d1ibeb_

PDB Entry: 1ibe, 1.8 Å

PDB Description: deoxy-haemoglobin trapped in the high-affinity (r) state

SCOP Domain Sequences for d1ibeb_:

Sequence; same for both SEQRES and ATOM records:

>d1ibeb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d1ibeb_:

• d1ibeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ibeb_ appears in SCOP 1.65
  
• d1ibeb_ appears in SCOP 1.69
  
• d1ibeb_ appears in the current release, SCOPe 2.08